- Recombinant NAD (P)H-quinone oxidoreductase subunit L, organellar chromatophore
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1236380
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 9,791 Da
- E Coli or Yeast
- 30317
- NAD (P)H-quinone oxidoreductase subunit L, organellar chromatophore
Sequence
MSFFRYLSDISSETRTLLLAYGVLGGLYLILVPLALYWWMNRRWYIMGKIERLFVYGLVFLFFPGLILLSPFLNMRLKGQGET